PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02353.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 340aa    MW: 38000.1 Da    PI: 6.1249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02353.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +lv +++q+G+g+W++++   g+ R+ k+c++rw +yl
  Rsa1.0_02353.1_g00002.1 14 KGPWTPEEDIILVSYIQQHGPGNWRSVPLNTGLLRCSKSCRLRWTNYL 61
                             79******************************99************97 PP

2Myb_DNA-binding43.47.8e-1467109145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+
  Rsa1.0_02353.1_g00002.1  67 RGNFTQPEEKTIIRLQALLGNR-WAAIASYLP-QRTDNDIKNYWN 109
                              89********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.012965IPR017930Myb domain
SuperFamilySSF466894.4E-3011108IPR009057Homeodomain-like
SMARTSM007174.7E-141363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001673.39E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2365116IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.39166116IPR017930Myb domain
PfamPF002497.0E-1367109IPR001005SANT/Myb domain
CDDcd001672.19E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRPPCCGKM EVKKGPWTPE EDIILVSYIQ QHGPGNWRSV PLNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TQPEEKTIIR LQALLGNRWA AIASYLPQRT DNDIKNYWNI HLKKKLEQNL  120
QNGITNEDNT DMTEIPSCSI HSNSCNNNNN NKRVVNKGQW EKKLQTDINM AKQALLQALS  180
LDQPSSSIPP DPDSSKTHHS AKSTYASSTD NIFKLLQNWT SSSSSMPNTS SHSMNLSSST  240
GEGGVLDHHS FFSSHSESGS VDGKLNLMAE TRIFKGDQSK PNADIEATTN ATIDDHGSLS  300
LIEQWLYDDQ GMGPCDDDQE DLFDVSLEGM DNDNNCQHLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128055.10.0PREDICTED: myb-related protein 306-like
RefseqXP_013674873.10.0PREDICTED: myb-related protein 306-like
SwissprotP813928e-96MYB06_ANTMA; Myb-related protein 306
TrEMBLM4CVB30.0M4CVB3_BRARP; Uncharacterized protein
STRINGBra008160.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.11e-142myb domain protein 31